Cagrilinatide 10mg is an innovative once-monthly injectable weight-loss drug. It employs a unique "dual-target" mechanism: on one hand, it activates the GLP-1 receptor (increasing satiety and delaying gastric emptying), and on the other hand, it antagonizes the GIP receptor (a differentiated design from mainstream drugs). These two mechanisms work synergistically to achieve potent weight loss. Its core feature is the use of antibody fusion protein technology, achieving an ultra-long duration of action. Requiring only monthly subcutaneous injections, it offers a significant potential advantage in terms of convenience. At its highest dose, it can achieve an average weight loss of approximately 14.5% within 48 weeks, demonstrating significant efficacy and a safety profile similar to other drugs in its class. It aims to provide obese and overweight patients with a new, highly effective, and convenient long-term treatment option.
weight-related health problem (e.g., type 2 diabetes, hypertension, or dyslipidemia).

Test Report
|
Shaanxi Lymall Bpanda Tech Co., Ltd |
|||
|
Certificate of Analysis |
|||
|
Product Name |
Cagrilintide |
CAS |
|
|
Salt Type |
HAc+ |
Batch No. |
|
|
Sequence |
{Eicosanedioicacid-γ-Glu}-KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP-NH2 (Disulfide bridge:Cys3-Cys8) |
||
|
Quantity |
1000KG |
Analysis Date |
|
|
Test Reference |
In-house specification/Protocol specification |
||
|
Test ltems |
Specification |
|
|
|
Appearance |
White to off white powder or loose lump |
|
|
|
Solubility |
Soluble in water |
|
|
|
Mass Spectrum |
4409.07±1.0 |
|
|
|
Clarity and color of |
Clear and colorless |
|
|
|
Acetic acid |
≤ 10.0% |
|
|
|
Trifluoacetate ion |
≤0.5% |
|
|
|
Water |
≤ 10.0% |
|
|
|
Purity |
≥98% |
|
|
|
Bacterial endotoxin |
<10EU/mg |
|
|
|
Packaging and storage |
Store at a temperature of 2~8℃, protected from light |
||
|
Conclusion |
The test results comply with the requirements of in-house specification. |
||
|
Remark |
It is only supplied as chemical product. |
||
Who is Cagrilintide Suitable for?
1.Obese adults: Body mass index (BMI) ≥ 30 kg/m².
2.Overweight adults with comorbidities: BMI ≥ 27 kg/m², and at least one

Why you Choose Lymall Bpanda?
1. Flexible Dosage: Multiple Sizes Available
We offer a variety of pre-filled dosage sizes, such as 5 mg, 10 mg, and 15 mg, instead of a single fixed dose.
2. Convenient Management: Customizable Cap Colors
The color of the peptide caps can be customized to differentiate between different sizes and dosages.
3. Exclusive Identity: Customizable Labels and Packaging
We support a degree of customization for labels and outer packaging. Personalized reminders such as your own brand logo can be integrated into the packaging, providing a premium, personalized service experience for high-net-worth clients, private clinics, or specific health management plans.
Hot Tags: cagrilintide 10mg, China cagrilintide 10mg manufacturers, suppliers, factory

