Cagrilintide 10mg

Cagrilintide 10mg

Name: Cagrilintide 10mg
CAS: 1415456-99-3
Formula: C₁₉₄H₃₁₂N₅₄O₅₉S₂,
Appearance: White Lyophilized powder
Purity: ≥99%(HPLC)
Specification: 5mg/vial, 10vials/box
10mg/vial, 10 vials/box
20mg/vial, 10 vials/box
30mg/vial, 10 vials/box
Storage: -20℃ sealed and protected from light
Send Inquiry
Description
Technical Parameters

Cagrilinatide 10mg is an innovative once-monthly injectable weight-loss drug. It employs a unique "dual-target" mechanism: on one hand, it activates the GLP-1 receptor (increasing satiety and delaying gastric emptying), and on the other hand, it antagonizes the GIP receptor (a differentiated design from mainstream drugs). These two mechanisms work synergistically to achieve potent weight loss. Its core feature is the use of antibody fusion protein technology, achieving an ultra-long duration of action. Requiring only monthly subcutaneous injections, it offers a significant potential advantage in terms of convenience. At its highest dose, it can achieve an average weight loss of approximately 14.5% within 48 weeks, demonstrating significant efficacy and a safety profile similar to other drugs in its class. It aims to provide obese and overweight patients with a new, highly effective, and convenient long-term treatment option.

weight-related health problem (e.g., type 2 diabetes, hypertension, or dyslipidemia).

 

product-474-248

 

Test Report

 

Shaanxi Lymall Bpanda Tech Co., Ltd

Certificate of Analysis

Product Name

Cagrilintide

CAS

 

Salt Type

HAc+

Batch No.

 

Sequence

{Eicosanedioicacid-γ-Glu}-KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP-NH2 (Disulfide bridge:Cys3-Cys8)

Quantity

1000KG

Analysis Date

 

Test Reference

In-house specification/Protocol specification

Test ltems

Specification

 

Appearance

White to off white powder or loose lump

 

Solubility

Soluble in water

 

Mass Spectrum

4409.07±1.0

 

Clarity and color of
solution

Clear and colorless

 

Acetic acid

≤ 10.0%

 

Trifluoacetate ion

≤0.5%

 

Water

≤ 10.0%

 

Purity

≥98%

 

Bacterial endotoxin

<10EU/mg

 

Packaging and storage

Store at a temperature of 2~8℃, protected from light

Conclusion

The test results comply with the requirements of in-house specification.

Remark

It is only supplied as chemical product.

 

Who is Cagrilintide Suitable for?

 

1.Obese adults: Body mass index (BMI) ≥ 30 kg/m².

2.Overweight adults with comorbidities: BMI ≥ 27 kg/m², and at least one

 

product-1200-630

 

Why you Choose Lymall Bpanda?

 

1. Flexible Dosage: Multiple Sizes Available

We offer a variety of pre-filled dosage sizes, such as 5 mg, 10 mg, and 15 mg, instead of a single fixed dose.

2. Convenient Management: Customizable Cap Colors

The color of the peptide caps can be customized to differentiate between different sizes and dosages.

3. Exclusive Identity: Customizable Labels and Packaging

We support a degree of customization for labels and outer packaging. Personalized reminders such as your own brand logo can be integrated into the packaging, providing a premium, personalized service experience for high-net-worth clients, private clinics, or specific health management plans.

 

Hot Tags: cagrilintide 10mg, China cagrilintide 10mg manufacturers, suppliers, factory

Send Inquiry